NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207937_1001228

Scaffold Ga0207937_1001228


Overview

Basic Information
Taxon OID3300020544 Open in IMG/M
Scaffold IDGa0207937_1001228 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8426
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (23.81%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029090Metagenome / Metatranscriptome189N
F058098Metagenome / Metatranscriptome135N
F058685Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0207937_100122814F058098N/AMSPFRKKVDRIILTPTVRKIIFNMSERRQFQIINKETTLLYGAVKLLAENNFKAVIDDIDTNCMELNQTNIQMYQKLNETLSCLKEIDPEWKIAAETRETFVPVVLIECLREGVSLIDTSDLEDLNFGIYNLVHQILGRIREFDPTWSINSSMRFEALK
Ga0207937_100122817F058685AGGAMKGRELKSYPCARFNCNQMIKKNRPKRKILLNPGVKSVRALIKNKCITRLAKQRSMIKNKKLNLLIKPCTTSRKSNSNHPNGSSINKRVVVNYPFIPVKLHFLSKKSREWIKLASPMKAIKPSIPAKPNILINKNVLANQITYLISLASYNMKVKSFIPDRLNVLINNSTLGDQIIYSKINYPLIPVEYIATNKSNIMKEKSILRIDRSTPVGACSFQKRIQGTQIPVFPIPARTILW
Ga0207937_100122821F029090N/AMKQKSKVATFTPYTKTECQRLRLIMPGVPSKKQEFIRLLDRINAPSYVDLMISLLCKAVNSIDPYEDDQYNTVRYRKIYDLLSIIKNKRPTWKLAYIAQDIEAFKQKADILNKVYRGVSFFVRQEMKQENHFRLIYETINSIDLKKGYTKNFKWFKKLKNNLKFVYGRSPKWALHYQEPALPDLGNLTENDFN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.