NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207939_1009587

Scaffold Ga0207939_1009587


Overview

Basic Information
Taxon OID3300020536 Open in IMG/M
Scaffold IDGa0207939_1009587 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1547
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023321Metagenome / Metatranscriptome210Y
F057311Metagenome / Metatranscriptome136Y
F081259Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0207939_10095872F057311N/AMQKKSSNRKTKNLRLDIEGKTKFWQPVVRNGWWIKFSTYRDHYILLMIISKYTGQTILRYYEDESEAVAFINFITTCKAQDIFQSA
Ga0207939_10095873F023321AGGAGMFLNQPQFPTFYTWNDIQRKAESATIKTIDFNKVLVDHTIAYFDSVTENHFTTYTKKVVNLNNNIAEDAKKIIKSENKESKA
Ga0207939_10095874F081259AGGAGMFKKFINWFTQRQMTEIEYFIATRDPKTTADVEQLIKEFNYKRRLQCF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.