Scaffold Ga0208601_1051183

Overview

Basic Information

• Taxon OID: 3300020532
• Scaffold ID: Ga0208601_1051183
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 574
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091436	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208601_10511832	F091436	GGAGG	MKGYDALQCSLISRGYAGKHLGHLSELSFLPDKVARFLFEFHADDYKSLGLPAVPPFASSGTIHKILKTNHVCIRKTSKYFYLIFIVSKFI