NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208232_1044966

Scaffold Ga0208232_1044966


Overview

Basic Information
Taxon OID3300020527 Open in IMG/M
Scaffold IDGa0208232_1044966 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)568
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060591Metagenome132N

Sequences

Protein IDFamilyRBSSequence
Ga0208232_10449661F060591N/ATHETTKLIDPYLPHIQSVVDLGAQNDYRVPLPAPYTKDSYYAGKDYEAIDISGENGSTPLDLSVLHKFSKQFDLLVDAGTSEHVGTDGRHNIKAIYNCWKNKHNLVKLGGYIISENPKTGNWPGHGFNYYTEEFYRNLAAICGYNLIDVGSVAAMGNTTDGWNVYSILQKTKEEFCTLTEFKTCGIKTD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.