NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208858_1001130

Scaffold Ga0208858_1001130


Overview

Basic Information
Taxon OID3300020524 Open in IMG/M
Scaffold IDGa0208858_1001130 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4824
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004762Metagenome / Metatranscriptome424Y
F009683Metagenome / Metatranscriptome314Y
F014016Metagenome / Metatranscriptome266N

Sequences

Protein IDFamilyRBSSequence
Ga0208858_100113011F009683N/AMKDIREGEQVSDTQKSLNEWLESAGDTLFDRGIEYGDPRHNLLRIFKISKALGIQLRDPSDLAIIAIATKLSRMVESPEREDSYLDLIGYAAILGRLRFSTPEDW
Ga0208858_10011304F004762AGGAGMASPEQVLLFLRPNGGYVQVGTEYEGIIFQPSCEPFTKSEYEAGFAQYDAWKAQQEAEQAAAKAAAEAKLEALGLTADDLKALGL
Ga0208858_10011309F014016GGAMINKVALIRFDSQAGAWTDETNWVKGSIIRRFAKERMGKKQLRGRLSKAEISAYWLDKYGVDADVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.