NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207418_100980

Scaffold Ga0207418_100980


Overview

Basic Information
Taxon OID3300020483 Open in IMG/M
Scaffold IDGa0207418_100980 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2953
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039598Metagenome / Metatranscriptome163Y
F040488Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0207418_1009803F039598AGGAGMETLVVLILLAFAVWVVWKLVKDPDKNDDGVVDHKDVVVAAKEVAVEAKTEAVKVAEKVTEKVTEKVKKPRAKKAK
Ga0207418_1009806F040488GGAGGMKYILALSLLFLAGCANPLTRLVPKIEMPEPPKELMAPPKPLKTIIPAAPAQSELLRDVTPAGQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.