NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211503_10005946

Scaffold Ga0211503_10005946


Overview

Basic Information
Taxon OID3300020478 Open in IMG/M
Scaffold IDGa0211503_10005946 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9209
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_034
CoordinatesLat. (o)18.49Long. (o)39.8483Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025055Metagenome203Y
F069319Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0211503_1000594610F025055GAGMIEKLLKADGKRYIKKTFDYKGEDNFTFLKNEVFWLNYLKSKWVPELEEVGDNYVITRYYGLDLNTLRNNKFKLADDLADQTLEMYKFFKEKNVFKLNGALSNLTMNGNQLVAFDWKWARFRTDKYKDYEVISYEKWLSKIDSELVEKLKCMI
Ga0211503_100059462F069319GGAMMLKSYIFKPTELPQKYRSQITDIIKDVVDRKTDPYWKNYTDREFNLDEQTAISINCDGDDVKAISSIYHREFFGEGVYRLMNRSLYSKDYRESGGSKTRSGEHTAHKMIALQVDFVEKLNPKFYFISRQRTNMRFLKYYFDKFNSDYNKNFIISDTQYWVCPGKKDNCLQTIIYPKDFKVSLKPYK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.