Scaffold Ga0211543_10256695

Overview

Basic Information

• Taxon OID: 3300020470
• Scaffold ID: Ga0211543_10256695
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 855
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_041
• Coordinates
  • Lat. (^o): 14.5375
  • Long. (^o): 70.0244
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091881	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211543_102566953	F091881	GGAGG	MRIGDLVRIKKIWRNIYKDYEDTVGLVVYADSGYVTERPVGFRRIRILHGDIKGQIYSVFAEEVLEVVKN