NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211713_10017866

Scaffold Ga0211713_10017866


Overview

Basic Information
Taxon OID3300020467 Open in IMG/M
Scaffold IDGa0211713_10017866 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3585
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (41.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_112
CoordinatesLat. (o)-23.1569Long. (o)-129.5943Alt. (m)Depth (m)155
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061923Metagenome131Y
F101344Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0211713_100178667F101344GGAMNSTMRFHALTDNTGNFLRCAPNNYPYGTPPKLEGNEMDYREPTWDDVPDKFMNFEDDACKCFSCGGWFPTEDCVINHDEEYKGVPVCDTCAEGRFLL
Ga0211713_100178668F061923AGTAGMRPETRANLGKQGAEIASVRGTLQALAESWGADVKYLQTRIADAEEKLTKIQNTLAEIEWSEEVDWMGKLNE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.