Scaffold Ga0211694_10451109

Overview

Basic Information

• Taxon OID: 3300020464
• Scaffold ID: Ga0211694_10451109
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 557
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_078
• Coordinates
  • Lat. (^o): -30.1495
  • Long. (^o): -43.2486
  • Depth (m): 120

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028525	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211694_104511091	F028525	GAG	MSRTLKEVRENLLEATMASKTNLQYIRAKTASNNHFEARRYIAKEIL