Scaffold Ga0211642_10350369

Overview

Basic Information

• Taxon OID: 3300020449
• Scaffold ID: Ga0211642_10350369
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 635
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_110
• Coordinates
  • Lat. (^o): -1.8191
  • Long. (^o): -84.6284
  • Depth (m): 380

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060036	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211642_103503691	F060036	GAG	MKIKVITSYKPGCWEQYGKKGIESMAEQFPKEIDIVVYAEEPKPQCKYDRIQWID