Scaffold Ga0211638_10406912

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211638_10406912

Scaffold Ga0211638_10406912

Overview

Basic Information
Taxon OID	3300020448 Open in IMG/M
Scaffold ID	Ga0211638_10406912 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	638
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_112
Coordinates	Lat. (^o)	-23.24	Long. (^o)	-129.4851	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005533	Metagenome / Metatranscriptome	397	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211638_104069122	F005533	GAGG	MSYTKNEVALETLISNINNQFYYIGEENDQVAPIDVKKFTEYCVTFIDSLEIEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.