Scaffold Ga0211695_10050216

Overview

Basic Information

• Taxon OID: 3300020441
• Scaffold ID: Ga0211695_10050216
• Source Dataset Name: Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1339
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_078
• Coordinates
  • Lat. (^o): -30.1885
  • Long. (^o): -43.2831
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049704	Metagenome / Metatranscriptome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211695_100502163	F049704	N/A	IIKDMTDHYYYYEAMLGTGKMIHLFARDDIEAAYRAAHIAKYHWHTTLTDIWLDKHHMNNKERHEKEGVS