Scaffold Ga0211525_10080929

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211525_10080929

Scaffold Ga0211525_10080929

Overview

Basic Information
Taxon OID	3300020423 Open in IMG/M
Scaffold ID	Ga0211525_10080929 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000315 (ERX556027-ERR599062)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1476
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_037
Coordinates	Lat. (^o)	20.8188	Long. (^o)	63.6158	Alt. (m)		Depth (m)	600
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008084	Metagenome / Metatranscriptome	339	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211525_100809292	F008084	N/A	MNAILQKIGRWHSKVFGYVSNKAKTSKWWAIALTLLVLYEIVEHVVYPILVPYLAYMHWF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.