Scaffold Ga0211528_10041981

Overview

Basic Information

• Taxon OID: 3300020417
• Scaffold ID: Ga0211528_10041981
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2051
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_038
• Coordinates
  • Lat. (^o): 19.0108
  • Long. (^o): 64.532
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023951	Metagenome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211528_100419811	F023951	GAGG	MEGIVTALAQYGPLGLWTASLLWMNWQGSKDRKQAEREAAEALRYHREQIVMRLIEQEHMLEKALEKMDYGLQQMKEKYAEDRLLRMKDK