Scaffold Ga0211516_10047214

Overview

Basic Information

• Taxon OID: 3300020413
• Scaffold ID: Ga0211516_10047214
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2185
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_018
• Coordinates
  • Lat. (^o): 35.7593
  • Long. (^o): 14.3453
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033503	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211516_100472141	F033503	AGGAG	MKDTQLKKDIMNIAKAESADGITICCGTLFTKFNVSVHQQMADSLKLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVD