Scaffold Ga0211659_10000112

Overview

Basic Information

• Taxon OID: 3300020404
• Scaffold ID: Ga0211659_10000112
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 43645
• Total Scaffold Genes: 48
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 39 (81.25%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_102
• Coordinates
  • Lat. (^o): -5.254
  • Long. (^o): -85.2248
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007346	Metagenome / Metatranscriptome	353	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211659_100001122	F007346	GAGG	MNDNEIRGIRLSQALNWSGQDIFEVAAAAFEDANYHSFNEVFYAAWMEYQKELEDG