Scaffold Ga0211532_10036649

Overview

Basic Information

• Taxon OID: 3300020403
• Scaffold ID: Ga0211532_10036649
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2446
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_039
• Coordinates
  • Lat. (^o): 18.5679
  • Long. (^o): 66.4581
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091881	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211532_100366495	F091881	GGAGG	MQVGDLVRIRKAWKGLYKGYEDTVGLVVSIDTGYVGERPVGFRRIRITHGDIRGQIYSVFVEDVLEIVCSK