Scaffold Ga0211617_10014718

Overview

Basic Information

• Taxon OID: 3300020401
• Scaffold ID: Ga0211617_10014718
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3386
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_052
• Coordinates
  • Lat. (^o): -17.2387
  • Long. (^o): 53.9775
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016620	Metagenome / Metatranscriptome	246	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211617_100147182	F016620	GAGG	MLRKLTKQLLLNESFKVDPAASVQALYDIISNVRVTNKRDTNRISLAKEHIRGIKRHLRSLNERIHSLEEELKILTEDK