Scaffold Ga0211687_10177430

Overview

Basic Information

• Taxon OID: 3300020396
• Scaffold ID: Ga0211687_10177430
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 870
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_082
• Coordinates
  • Lat. (^o): -47.1208
  • Long. (^o): -57.8265
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072441	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211687_101774303	F072441	N/A	MFNKDNINNVNAATIIEGPEEVLNSNEENNPKITDSNP