Scaffold Ga0211677_10061808

Overview

Basic Information

• Taxon OID: 3300020385
• Scaffold ID: Ga0211677_10061808
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1698
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_093
• Coordinates
  • Lat. (^o): -33.832
  • Long. (^o): -73.0366
  • Depth (m): 35

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050007	Metagenome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211677_100618082	F050007	N/A	GRYVVLDARLPHVARAVENDKFRVSLVFKGTTLGAPKPDETEFKEVE