Scaffold Ga0211596_10055397

Overview

Basic Information

• Taxon OID: 3300020384
• Scaffold ID: Ga0211596_10055397
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1318
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_065
• Coordinates
  • Lat. (^o): -35.2528
  • Long. (^o): 26.317
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054095	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211596_100553972	F054095	GGA	MIPQWKMNGKDMRFDGSIEIGVVEVRDLFDDLVVTLWVDQEESGSIAVKTLGGIGNGRYSVQILP