Scaffold Ga0211476_10283731

Overview

Basic Information

• Taxon OID: 3300020381
• Scaffold ID: Ga0211476_10283731
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 566
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_030
• Coordinates
  • Lat. (^o): 33.93
  • Long. (^o): 32.7322
  • Depth (m): 70

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088982	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211476_102837311	F088982	N/A	GKCEPKERVAHCSSVKLRGFSVIYDFFEGYVFMKPNMIKKWSIALLVAAGATGLTGCEGMRVDEGAGTATNNGNIAVSPNGAALKANLSGTVVDDFGVALSGVSVYAYGRTTTTDAGGNWILTNVPVTGVNINSTPQNLEQTTDVTTQGSIYVTYSKSGYAEYKSKISNPAVITHYGTAGGNPNSIIV