Scaffold Ga0211647_10012685

Overview

Basic Information

• Taxon OID: 3300020377
• Scaffold ID: Ga0211647_10012685
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3548
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB59 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_109
• Coordinates
  • Lat. (^o): 2.0663
  • Long. (^o): -84.5304
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056587	Metagenome / Metatranscriptome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211647_100126856	F056587	N/A	MKFVLITLSLFFISFKTYAIQIVGSEKLCQDLVILMGNNDDDLEVLYNELISGQLVEEDKFLKMKEIENYVLKISTLYHNLCTPH