Scaffold Ga0211477_10023758

Overview

Basic Information

• Taxon OID: 3300020374
• Scaffold ID: Ga0211477_10023758
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2686
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_030
• Coordinates
  • Lat. (^o): 33.93
  • Long. (^o): 32.7322
  • Depth (m): 70

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003097	Metagenome / Metatranscriptome	507	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211477_100237583	F003097	N/A	MMKRYMQGELAPDSPKAPIEKMAIDPNSKVTQGATSGDGNDAKGKSKSKVDPAIFRMAEQRDY