Scaffold Ga0211608_10002566

Overview

Basic Information

• Taxon OID: 3300020354
• Scaffold ID: Ga0211608_10002566
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000408 (ERX555905-ERR599164)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6499
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_064
• Coordinates
  • Lat. (^o): -29.5082
  • Long. (^o): 37.9202
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098022	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211608_100025665	F098022	N/A	MKKVFPVKLLDAARFSFPASQCFSIIKERIFKERFFTFKAEERLLKDTDSFCAGTETGHSFAETGLAAAHSAV