NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211688_1031937

Scaffold Ga0211688_1031937


Overview

Basic Information
Taxon OID3300020317 Open in IMG/M
Scaffold IDGa0211688_1031937 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1105
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_082
CoordinatesLat. (o)-47.1208Long. (o)-57.8265Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004990Metagenome416Y
F008915Metagenome / Metatranscriptome326Y

Sequences

Protein IDFamilyRBSSequence
Ga0211688_10319372F004990GGAMYGDPKKPCCVCKKEADLNERGKRYCADHYALYILGKSMEQIDKELKK
Ga0211688_10319373F008915N/AAHLGILRCLESKKNKESWGYNYKGSLNDQMAKSISGAMGEVAASKFLGIKFEYHCNVGGVPDLIFKDLKLQVRTQLPKDHNKNSLIIRPKAKANEFYILVIDEAPDFKILGFVNSTYVLGQDRFKTDFGLARPPCYSIPPDKLTPINLLKDSSWN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.