Scaffold Ga0211522_1041884

Overview

Basic Information

• Taxon OID: 3300020314
• Scaffold ID: Ga0211522_1041884
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 811
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus → Celeribacter virus P12053L → Celeribacter phage P12053L (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_036
• Coordinates
  • Lat. (^o): 20.8199
  • Long. (^o): 63.5138
  • Depth (m): 17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052611	Metagenome / Metatranscriptome	142	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211522_10418842	F052611	GGA	MIDIETDTVNQRCVIKSDKMLSEIYVEKEDSGYIFFRVTFEKGKVPQELSGRYSSLEKGKQAVESYLRDKVKTKTLQRNEYADKREIERNGSKSKSKGS