Scaffold Ga0211474_1014026

Overview

Basic Information

• Taxon OID: 3300020296
• Scaffold ID: Ga0211474_1014026
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1466
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_018
• Coordinates
  • Lat. (^o): 35.7392
  • Long. (^o): 14.3321
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055735	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211474_10140262	F055735	GAG	MDKTNKDLIKNYYDQLAELQKQFWFERLDLKEYCVRYDAINKRIEELENG