Scaffold Ga0211530_1062577

Overview

Basic Information

• Taxon OID: 3300020295
• Scaffold ID: Ga0211530_1062577
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000071 (ERX555980-ERR599109)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 599
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_038
• Coordinates
  • Lat. (^o): 18.9918
  • Long. (^o): 64.5757
  • Depth (m): 340

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055789	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211530_10625771	F055789	N/A	EYEKALDDAKKEIFTLKQEIINLKAEVKYERELRIHGADYHKPKDYHSRLRQMIEIVKKDTKLTDIHDIVDEAQRRLVRE