Scaffold Ga0211520_1008623

Overview

Basic Information

• Taxon OID: 3300020294
• Scaffold ID: Ga0211520_1008623
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1686
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_025
• Coordinates
  • Lat. (^o): 39.3757
  • Long. (^o): 19.4167
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033503	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211520_10086231	F033503	AGGA	MKDTQLKKDIMNIAKAESADGITICCGTLFTKFGVSVHKQMADSLKLALQTFFDNRKKNDCVVKMSGPMGADEEYAYDFVPVVDFRLNGMGI