Scaffold Ga0211591_1009287

Overview

Basic Information

• Taxon OID: 3300020280
• Scaffold ID: Ga0211591_1009287
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2208
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_125
• Coordinates
  • Lat. (^o): -8.895
  • Long. (^o): -142.6228
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025996	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211591_10092877	F025996	AGGAG	MMDRKREISIGEFDQSIIQLQKHKFKLLEQVEQINLQISFLRQQQEQLINV