Scaffold Ga0211519_1053561

Overview

Basic Information

• Taxon OID: 3300020266
• Scaffold ID: Ga0211519_1053561
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 782
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_025
• Coordinates
  • Lat. (^o): 39.3599
  • Long. (^o): 19.4084
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014153	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211519_10535612	F014153	AGGA	MIYTKELLFSEFKEVTKKDEKSKKPSYKHRIAYLQSLKEDFDKSPKHFSNLNITSQQLQNLIDDWSAPKPIDAFYKRIFGMTFAEKKQQEELEYFIYENGEKKEVRKSKQETQSIH