Basic Information | |
---|---|
Taxon OID | 3300020251 Open in IMG/M |
Scaffold ID | Ga0211700_1008056 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1245 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_076 | |||||||
Coordinates | Lat. (o) | -21.0675 | Long. (o) | -35.3923 | Alt. (m) | Depth (m) | 150 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059358 | Metagenome / Metatranscriptome | 134 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211700_10080561 | F059358 | AGG | MYTLYYYRDEAYWTFAFPMQAFDFAERNEKTNGTEYVVMDSDGYFVHKKDLVSPSGVGVG |
⦗Top⦘ |