Scaffold Ga0211492_1001084

Overview

Basic Information

• Taxon OID: 3300020238
• Scaffold ID: Ga0211492_1001084
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5866
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_066
• Coordinates
  • Lat. (^o): -34.8986
  • Long. (^o): 18.03
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084269	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211492_10010844	F084269	GAG	MFRLKNKKQRKNSFIVLRAISRINKYEMNENDLYGAYNSLLNQQGSQSLTS