Scaffold Ga0212228_1357268

Overview

Basic Information

• Taxon OID: 3300020235
• Scaffold ID: Ga0212228_1357268
• Source Dataset Name: Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: JGI facility at Oak Ridge National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1783
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location

• Location Name: Kermadec Trench, Pacific Ocean
• Coordinates
  • Lat. (^o): -32.85037333
  • Long. (^o): -177.65414
  • Depth (m): 9177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084258	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212228_13572681	F084258	GGTGG	MRSETELKDLIQKAQRADQLLNDPMIQEFIISCRGDLLNRFESTELSSEAERLSAYNQGQVLKLFLDKFTKAIKEGKDARSMLEQAKHTLRNII