NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212228_1276044

Scaffold Ga0212228_1276044


Overview

Basic Information
Taxon OID3300020235 Open in IMG/M
Scaffold IDGa0212228_1276044 Open in IMG/M
Source Dataset NameDeep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJGI facility at Oak Ridge National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1547
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location
Location NameKermadec Trench, Pacific Ocean
CoordinatesLat. (o)-32.85037333Long. (o)-177.65414Alt. (m)Depth (m)9177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083231Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0212228_12760445F083231GAGMPSKDGKIFDTIVYIGLSINVVVATYLFLMYFEVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.