Basic Information | |
---|---|
Taxon OID | 3300020235 Open in IMG/M |
Scaffold ID | Ga0212228_1129330 Open in IMG/M |
Source Dataset Name | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | JGI facility at Oak Ridge National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1012 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kermadec Trench, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -32.85037333 | Long. (o) | -177.65414 | Alt. (m) | Depth (m) | 9177 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077318 | Metagenome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212228_11293302 | F077318 | N/A | MIAEIIKILQTKDFYGAGEYTEIAKGKHEIVTSFKGMKRKIKRLWRLSR |
⦗Top⦘ |