Basic Information | |
---|---|
Taxon OID | 3300020235 Open in IMG/M |
Scaffold ID | Ga0212228_1077173 Open in IMG/M |
Source Dataset Name | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | JGI facility at Oak Ridge National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2280 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kermadec Trench, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -32.85037333 | Long. (o) | -177.65414 | Alt. (m) | Depth (m) | 9177 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078729 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212228_10771733 | F078729 | AGGA | MTDETRRLLKVFGVAVTDFETEAEKLAANAARVAGASGKEEVAKLLKDTTELCRELNTRWLETTQHVFAAQNRLLYLCAKAAARLQSEDVITEIESARMEAGE |
⦗Top⦘ |