Basic Information | |
---|---|
Taxon OID | 3300020222 Open in IMG/M |
Scaffold ID | Ga0194125_10861102 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 512 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tanzania: Lake Tanganyika | |||||||
Coordinates | Lat. (o) | -4.9054 | Long. (o) | 29.4853 | Alt. (m) | Depth (m) | 250 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032248 | Metagenome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0194125_108611021 | F032248 | GGA | MRLCFKCKCVIPMERIEVLPETQTCVGCSGVEKYVGAMVFDHKTAGRLEYVNPKNKQA |
⦗Top⦘ |