Scaffold Ga0194125_10861102

Overview

Basic Information

• Taxon OID: 3300020222
• Scaffold ID: Ga0194125_10861102
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -4.9054
  • Long. (^o): 29.4853
  • Depth (m): 250

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032248	Metagenome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194125_108611021	F032248	GGA	MRLCFKCKCVIPMERIEVLPETQTCVGCSGVEKYVGAMVFDHKTAGRLEYVNPKNKQA