NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194125_10515395

Scaffold Ga0194125_10515395


Overview

Basic Information
Taxon OID3300020222 Open in IMG/M
Scaffold IDGa0194125_10515395 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)729
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.9054Long. (o)29.4853Alt. (m)Depth (m)250
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034747Metagenome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0194125_105153952F034747N/AMSRNAYRVIRIITAKNPTFNMSYDEELVSILEESANIFDSLNSYGNGIFDILEDEFKEVKEKIEELIDGLESTKTNKPENKEKAKCYRKVLAEMERVIKKEGYISYQIYXEYKSD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.