Scaffold Ga0194116_10167962

Overview

Basic Information

• Taxon OID: 3300020204
• Scaffold ID: Ga0194116_10167962
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1291
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -6.4662
  • Long. (^o): 29.9408
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003805	Metagenome / Metatranscriptome	467	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194116_101679624	F003805	N/A	RKAATDQWIIDRFNSGDYRGLLEAALVLNSLHQLEKTKTDWAIREAADNLAGQFGMDRDS