NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194131_10078143

Scaffold Ga0194131_10078143


Overview

Basic Information
Taxon OID3300020193 Open in IMG/M
Scaffold IDGa0194131_10078143 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1933
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.8915Long. (o)29.586Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F000645Metagenome / Metatranscriptome962Y
F002241Metagenome / Metatranscriptome579Y
F004115Metagenome / Metatranscriptome452Y

Sequences

Protein IDFamilyRBSSequence
Ga0194131_100781431F004115N/ANKNQYCDYCKYRWGQNKGVWDIRATTPAVWKVQSETPLRKAQVRFYCQPCANEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP
Ga0194131_100781432F000645GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADAHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKVSQSPKKPIQTTKPALAEFIKEQRPNDPEPIVWDVSELAKELGAEVIDEMPLCPTGQCGPMVLKTGTKDGKEYRGWVCAKKNKAEQCAAKWMRIGADGHWVFQK
Ga0194131_100781433F000545N/AMRSDAHPFICSACKLVTPHIELHKYDVRDIAEAPEELWLVECQRCFTQRIIYPSDRVTAKEDDIVRCDQCGKWKMKAAKCRICRLAAGLESISERYWTGNETMERPYNANL
Ga0194131_100781434F002241AGGAGMGREEVSRPHSVKYIRQLMEWGFDKEFIARDCGINLESLETRLRRANQRERRNGNQGIESGTSSGESDS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.