Scaffold Ga0194131_10001339

Overview

Basic Information

• Taxon OID: 3300020193
• Scaffold ID: Ga0194131_10001339
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 42297
• Total Scaffold Genes: 40
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 33 (82.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -4.8915
  • Long. (^o): 29.586
  • Depth (m): 120

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040366	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194131_100013392	F040366	GGA	MADLDTTIEEFAAGGFTHIECHCPRCRVTRLRPINWLPRISMGLTIAQLSARLRCAECGGQLHSVQPWRMQDTLGKPLGRRG