Scaffold Ga0163147_10372544

Overview

Basic Information

• Taxon OID: 3300020192
• Scaffold ID: Ga0163147_10372544
• Source Dataset Name: Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 724
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Lake Vanda, McMurdo Dry Valleys
• Coordinates
  • Lat. (^o): -77.5281
  • Long. (^o): 161.59
  • Depth (m): 19

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069530	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163147_103725441	F069530	GAG	VDAPNLAGVSPTKQMRTALVEWTMLMDTSIWARNLSLDPFYLAIASKSNIVDNKY