Scaffold Ga0163147_10004419

Overview

Basic Information

• Taxon OID: 3300020192
• Scaffold ID: Ga0163147_10004419
• Source Dataset Name: Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17940
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (43.75%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Lake Vanda, McMurdo Dry Valleys
• Coordinates
  • Lat. (^o): -77.5281
  • Long. (^o): 161.59
  • Depth (m): 19

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043263	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163147_1000441916	F043263	N/A	CRPDLTTGAIPGQPGYGTPNGVVNNDDFFFYLSAFAAGNLAVADMTTTAIPGSPGYGVPNGVLNNDDFFFYLSIFSTPC