Scaffold Ga0211735_11511043

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211735_11511043

Scaffold Ga0211735_11511043

Overview

Basic Information
Taxon OID	3300020162 Open in IMG/M
Scaffold ID	Ga0211735_11511043 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	SciLifeLab
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	995
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location Name	Lake Erken, Sweden
Coordinates	Lat. (^o)	59.83763399	Long. (^o)	18.6203826	Alt. (m)		Depth (m)	8 to 14
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073534	Metagenome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211735_115110431	F073534	AGGAG	MFNFFNKKLPTDFNQVQEKGVEISEIFYQPNQQLQEDFNLIDKVNKSKFEDFQVSSFASFFEKLELIPTVDLGDVNLKIRTTNPSAPIDADLCQVWMRRTYTNPTTGQITEQWINWVPNDDAAKKYFKFS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.