Scaffold Ga0211726_10841187

Overview

Basic Information

• Taxon OID: 3300020161
• Scaffold ID: Ga0211726_10841187
• Source Dataset Name: Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: SciLifeLab
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 657
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location

• Location Name: Lake Erken, Sweden
• Coordinates
  • Lat. (^o): 59.83763399
  • Long. (^o): 18.6203826
  • Depth (m): 14 to 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063687	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211726_108411871	F063687	AGG	MTQNKTRLNTDIRKKIGGLILSHFENEKTPELENFISAKEDITTAYNTA