NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211726_10755288

Scaffold Ga0211726_10755288


Overview

Basic Information
Taxon OID3300020161 Open in IMG/M
Scaffold IDGa0211726_10755288 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20942
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (52.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)14 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007028Metagenome / Metatranscriptome359Y
F090401Metagenome / Metatranscriptome108Y
F101035Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0211726_1075528817F101035AGGMEAIFVALIAAVGGILAALVQMGRKENKDDHNVVANLLVNVKDDIIHLHQKLDHLDDQVDKVDDKIDVHLKSHRGK
Ga0211726_1075528823F007028AGGVPKISKNALEQSIDSPLDQVVNLMTQEITVSTNPVFICGVNRKINIGNFENIDVYAGITIPLTDIDPSDREALSEAVKQAAADGFGIVSRETGERYSIIKESQQGK
Ga0211726_107552883F090401AGGAGMARKYTGNSDGDGKGAKPGTQKLIELCGKRWKFSNLGAYSNRLMRNSNTAGKKLGDPGMEKWLSVHATGRACDVGYTDRKAAVEAWDWFLKYSKELGIEEIHDYAFDSDKADKNVGYGRGYRCSRGEGSKGVKVYDAKDNAGSFGGKWLHFELSPEMANDAAKFEAAWRALPKPGAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.