Basic Information | |
---|---|
Taxon OID | 3300020151 Open in IMG/M |
Scaffold ID | Ga0211736_10241867 Open in IMG/M |
Source Dataset Name | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | SciLifeLab |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1396 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erken, Sweden | |||||||
Coordinates | Lat. (o) | 59.83763399 | Long. (o) | 18.6203826 | Alt. (m) | Depth (m) | 4 to 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092066 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211736_102418674 | F092066 | N/A | MKIDGGALEFFQSIPDDMLAQIAFHDRDSLERLCVALTLDVQLIIEEAERKNSKKKKKNLAS |
⦗Top⦘ |